Description
PrymaLab · Research use only
Preloaded Autoinjector | Cagrilintide | 3ml Pen | 20mg
Cagrilintide in bacteriostatic water at 0.67% w/v, 20 mg in a preloaded 3 mL pen
Cagrilintide is a long-acting amylin analogue: the 37-residue amylin backbone with proline substitutions and a C20 fatty diacid on its first lysine. This listing is a preloaded pen with 3 mL of ready-made solution in bacteriostatic water, 20 mg of cagrilintide in all, so there is no powder to reconstitute. The research on cagrilintide concerns amylin receptor pharmacology and clinical trials of the peptide alone and with semaglutide.
Specifications
| Property | Value |
|---|---|
| Compound | Cagrilintide AM833; long-acting acylated amylin analogue |
| CAS number | 1415456-99-3 |
| Molecular formula | C194H312N54O59S2 |
| Theoretical mass | 4409.0 Da |
| Sequence / structure | (C20 diacid-γGlu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (37 residues; Cys2–Cys7 disulfide; Lys1 acylated with eicosanedioic acid via γ-Glu; C-terminal amide) |
| Contents | Cagrilintide: 20 mg per 3 mL pen (0.67% w/v) |
| Form | Sterile aqueous solution in bacteriostatic water (0.9% benzyl alcohol), supplied in a 3 mL glass cartridge inside a preloaded autoinjector pen fitted with a needle |
| Storage, sealed | Store at 2–8 °C in the original carton, protected from light |
| Safety data sheet | PL-SDS-027 |
What is in the pen
Each pen contains a 3 mL glass cartridge of sterile aqueous solution. Cagrilintide is present at 0.67% w/v, 20 mg per pen, which is about 6.7 mg/mL, or roughly 1.5 µmol/mL at the theoretical mass of 4409.0 Da. The solvent is bacteriostatic water with 0.9% benzyl alcohol as an antimicrobial preservative. On the safety data sheet, cagrilintide is classed Repr. 2 (H361, suspected of damaging fertility or the unborn child), and benzyl alcohol is listed as harmful if swallowed or inhaled, a serious eye irritant and a possible skin sensitiser.
Keep the pen at 2 to 8 °C in the original carton, out of the light, capped between uses and locked away from unauthorised persons. Never freeze it, and discard it if the solution has frozen, discoloured or become cloudy. Freeze-dried cagrilintide is sold in Cagrilintide 10mg vials, and peptide pen vs vial explains what changes between the formats.
What the research covers
Amylin is a 37-amino-acid hormone from pancreatic beta cells, and its receptors are multi-subunit G protein-coupled receptors built from a core receptor protein and receptor activity-modifying proteins1. Its main site of action, according to Hay and colleagues, is the circumventricular organs of the central nervous system1. Human amylin readily forms amyloid fibrils, which made it a difficult drug template, and the earlier analogue pramlintide, used with insulin in diabetes, has a short half-life2. Kruse and colleagues described the structure-activity work behind cagrilintide, which they chose for clinical development in obesity because it was stable and long-acting2.
Human studies began with cagrilintide alone: a 26-week phase 2 trial compared five cagrilintide strengths with liraglutide and placebo, with the percentage change in body weight as the primary endpoint3. It enrolled adults without diabetes and masked participants and investigators to active versus placebo treatment3. Later trials combined cagrilintide with semaglutide. None of them used a pen like this one or any research solution, and the abstracts give no data on how long cagrilintide stays intact in bacteriostatic water, so the storage limits on the safety data sheet are the ones to follow.
The full literature, from the receptor potency data to the phase 3 programme and its safety tables, is in the cagrilintide and CagriSema guide.
How each lot is tested
Every lot is tested in PrymaLab’s own laboratory in Ashland, Kentucky before release: RP-HPLC for purity, LC-MS for identity, Karl Fischer titration for water, LAL for endotoxin and USP <71> for sterility. Published certificates are listed on the results page and can be checked by number and key on the verify page. The certificate covers the peptide lot used to fill the pen, not the finished solution. These are in-house results from PrymaLab Analytical, not an independent test, and the lab is not accredited to ISO 17025. The third-party testing guarantee on this page still applies: if any independent laboratory finds the wrong compound, or less than the stated purity or amount, the order is refunded and the cost of the test is reimbursed.
Frequently asked questions
How does the pen differ from the cagrilintide vials?
The vials hold freeze-dried peptide kept at −20 °C and dissolved in the lab at whatever concentration the work needs. The pen holds 20 mg already dissolved in 3 mL of bacteriostatic water and is kept at 2 to 8 °C, never frozen.
What concentration is the solution?
0.67% w/v, which is 20 mg in 3 mL or about 6.7 mg/mL. At cagrilintide's theoretical mass of 4409.0 Da that is roughly 1.5 µmol/mL, or about 4.5 µmol in the whole pen.
What does the certificate cover for the pen?
The certificate belongs to the cagrilintide lot that filled the pen; the finished solution in the cartridge has no certificate of its own. The testing section on this page explains where published certificates are listed and how to confirm one by its number and key.
Is the pen intended for human use?
No. Cagrilintide is investigational, and the pen is sold only for laboratory research. It is not a drug product, is not approved for human or veterinary use and must not be used in people or animals.
References
- Hay DL, Chen S, Lutz TA, et al. Amylin: Pharmacology, Physiology, and Clinical Potential. Pharmacol Rev. 2015;67(3):564-600. DOI · PubMed
- Kruse T, Hansen JL, Dahl K, et al. Development of Cagrilintide, a Long-Acting Amylin Analogue. J Med Chem. 2021;64(15):11183-11194. DOI · PubMed
- Lau DCW, Erichsen L, Francisco AM, et al. Once-weekly cagrilintide for weight management in people with overweight and obesity: a multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase 2 trial. Lancet. 2021;398(10317):2160-2172. DOI · PubMed
Research use only
For laboratory research use only. This product is not a drug, food, cosmetic or dietary supplement, is not approved by the FDA or any comparable authority for human or veterinary use, and must not be given to people or animals. It is sold to qualified researchers and institutions, and the buyer is responsible for lawful handling and disposal.
Other formats of Cagrilintide
Cagrilintide is also stocked as cagrilintide 2.5mg + semaglutide 2.5mg, Cagrilintide 5mg, Cagrilintide 5mg + Semaglutide 5mg, Semaglutide 5mg, Semaglutide 10mg, Semaglutide 15mg and Semaglutide 20mg. Each listing states its own quantity and concentration, and the pen and vial comparison explains what changes between formats.
Reviews
There are no reviews yet.