Name: Cagrilintide 5mg + Semaglutide 5mg
Brand: PrymaLab
SKU: PL-CAGRI-5MG-BLD
Price: 69.99 USD
Availability: InStock

Description

The smaller of PrymaLab’s two cagrilintide and semaglutide blends holds 2.5 mg of each peptide, 5 mg in all, co-lyophilised in a single vial. Cagrilintide is a lipidated amylin analogue and semaglutide a lipidated GLP-1 analogue, here at a fixed 1:1 ratio by mass. The pair’s research record is clinical: trials of cagrilintide given alongside semaglutide, with body weight as the main endpoint.

Specifications

cagrilintide 2.5mg + semaglutide 2.5mg at a glance
Property	Value
Components	Cagrilintide (AM833; long-acting acylated amylin analogue) Semaglutide (NN9535; GLP-1 receptor agonist)
Cagrilintide CAS number	1415456-99-3
Semaglutide CAS number	910463-68-2
Label claim	Cagrilintide 2.5 mg + Semaglutide 2.5 mg (5 mg in total)
Form	Lyophilized (freeze-dried) powder or cake in a sealed glass vial with a rubber stopper and aluminium crimp cap
Storage, sealed	−20 °C, desiccated, dark
Purity specification	99.0% or higher by RP-HPLC
Lot certificate	Results for the lot now shipping are in the certificate panel on this page
Safety data sheet	PL-SDS-028

Other fills

This is the 2.5 mg + 2.5 mg fill. The Cagrilintide 5mg + Semaglutide 5mg page is the main listing for this compound, with the full research summary and every fill side by side. Other fills: 5 mg + 5 mg.

What the research covers

Cagrilintide acts at amylin receptors, which pair a core receptor protein with one of several receptor activity-modifying proteins¹, while semaglutide binds the GLP-1 receptor². In REDEFINE 2, a 68-week phase 3a trial in adults with type 2 diabetes, the coadministered pair was compared with placebo on body weight, glycaemic measures and safety³. No trial tested the two peptides as a single freeze-dried preparation. The Cagrilintide 5mg + Semaglutide 5mg page carries the full research summary.

The Cagrilintide and CagriSema guide covers the literature in more depth.

How each lot is tested

Every lot is tested in PrymaLab’s own laboratory in Ashland, Kentucky before release: RP-HPLC for purity, LC-MS for identity, Karl Fischer titration for water, LAL for endotoxin and USP <71> for sterility. The results for the lot now shipping are in the certificate panel on this page, and the certificate number, key and QR code can be checked on the verify page. These are in-house results from PrymaLab Analytical, not an independent test, and the lab is not accredited to ISO 17025. The third-party testing guarantee on this page still applies: if any independent laboratory finds the wrong compound, or less than the stated purity or amount, the order is refunded and the cost of the test is reimbursed.

Frequently asked questions

How many micromoles of each peptide does the vial hold?

About 0.57 µmol of cagrilintide (4409.0 Da) and 0.61 µmol of semaglutide (4113.6 Da). The masses differ, so a 1:1 ratio by mass comes out close to, but not exactly, 1:1 in moles.

What does the certificate for this blend show?

One certificate covers the blend lot and gives an LC-MS identity mass for each peptide, so both components can be checked against their theoretical masses. The panel on this page shows the lot now shipping.

References

Hay DL, Chen S, Lutz TA, et al. Amylin: Pharmacology, Physiology, and Clinical Potential. Pharmacol Rev. 2015;67(3):564-600. DOI · PubMed
Lau J, Bloch P, Schäffer L, et al. Discovery of the Once-Weekly Glucagon-Like Peptide-1 (GLP-1) Analogue Semaglutide. J Med Chem. 2015;58(18):7370-80. DOI · PubMed
Davies MJ, Bajaj HS, Broholm C, et al. Cagrilintide-Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes. N Engl J Med. 2025;393(7):648-659. DOI · PubMed

Research use only

For laboratory research use only. cagrilintide 2.5mg + semaglutide 2.5mg is not a drug, food, cosmetic or dietary supplement, is not approved by the FDA or any comparable authority for human or veterinary use, and must not be given to people or animals. It is sold to qualified researchers and institutions, and the buyer is responsible for lawful handling and disposal.

Other formats of cagrilintide + semaglutide

cagrilintide + semaglutide is also stocked as Cagrilintide 5mg, Cagrilintide 10mg, Cagrilintide 20mg preloaded 3ml pen, Semaglutide 5mg, Semaglutide 10mg, Semaglutide 15mg and Semaglutide 20mg. Each listing states its own quantity and concentration, and the pen and vial comparison explains what changes between formats.

Additional information

Weight	N/A
Dimensions	N/A

Lot PL-2609-014 · Certificate of Analysis PL-26-00014

Every lot is tested in our own laboratory before it ships. These are the reference facts for this compound and the results for the lot currently shipping. Open the certificate page to verify it by QR code or number.

Compound	Cagrilintide / Semaglutide Blend Cagrilintide + Semaglutide co-lyophilized 1:1 blend
CAS number	1415456-99-3 · 910463-68-2
Molecular formula	C₁₉₄H₃₁₂N₅₄O₅₉S₂ · C₁₈₇H₂₉₁N₄₅O₅₉
Theoretical mass	4409.0 · 4113.6 Da (Cagrilintide / Semaglutide)
Sequence / structure	Cagrilintide 2.5 mg: `(C20 diacid-γGlu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (37 residues; Cys2–Cys7 disulfide; Lys1 acylated with eicosanedioic acid via γ-Glu; C-terminal amide)` Semaglutide 2.5 mg: `H-H-Aib-EGTFTSDVSSYLEGQAAK(2×OEG-γGlu-C18 diacid)EFIAWLVRGRG-OH (31 residues; Aib8 and Arg34 in GLP-1 numbering; Lys26 acylated with octadecanedioic acid via two OEG spacers and γ-Glu; free C-terminus)`
Appearance	White lyophilized powder
Storage	−20 °C, desiccated, dark
Label claim	5 mg/vial total (Cagrilintide 2.5 mg · Semaglutide 2.5 mg)
Lot number	`PL-2609-014`
Certificate number	`PL-26-00014`
Date of analysis	2026-09-18 (retest 2028-09-17)
Purity (RP-HPLC)	99.61%
Identity (LC-MS)	4113.8 Da (Semaglutide) · 4409.3 Da (Cagrilintide)
Water content (KF)	2.1%
Endotoxin (LAL)	0.05 EU/mg
Sterility	No growth; conforms
Conclusion	PASS
Tested by	PrymaLab Analytical (PrymaLab's own laboratory, Ashland, KY). In-house result, not an independent third-party test.

Third-party testing guarantee. Have this product tested by any independent laboratory. If the result does not come back as the compound named on the label, at the purity and amount stated, we refund your order in full and reimburse the cost of the test. Email the lab report and your order number to michael@prymalab.net.

Certificate of analysis for lot PL-2609-014, page 1 — Certificate page 1: results

Certificate of analysis for lot PL-2609-014, page 2 — Certificate page 2: method and approval

Download the COA (PDF) Verify certificate PL-26-00014 All published results

Safety data sheet PL-SDS-028 · Cagrilintide + Semaglutide Blend

GHS safety data sheet for this product (lyophilized powder, vial), revision 1.0 of October 3, 2026. Read all 16 sections or download the PDF to keep with the material.

Warning

H351 Suspected of causing cancer.
H361 Suspected of damaging fertility or the unborn child.

Composition	Cagrilintide (CAS 1415456-99-3) · 50%, 5 mg in Cagrilintide 5mg + Semaglutide 5mg; 2.5 mg in cagrilintide 2.5mg + semaglutide 2.5mg Semaglutide (CAS 910463-68-2) · 50%, 5 mg in Cagrilintide 5mg + Semaglutide 5mg; 2.5 mg in cagrilintide 2.5mg + semaglutide 2.5mg
Classification	Carcinogenicity (Category 2); Reproductive toxicity (Category 2)
Physical state	Solid. White to off-white lyophilized powder or cake.
Storage	−20 °C (sealed vial), desiccated and protected from light; 2–8 °C acceptable for short periods
Handling	Open vials only in a clean area. Avoid generating or inhaling dust; weigh or reconstitute inside a ventilated enclosure when the full contents are handled as a dry powder. Reconstitute by adding diluent slowly to the vial wall; do not shake. Wash hands after handling.
First aid	Eyes: Rinse cautiously with water for several minutes. Remove contact lenses if present and easy to do; continue rinsing. If eye irritation persists, get medical advice. Skin: Take off contaminated clothing. Wash the skin with plenty of soap and water. If irritation or a rash develops, get medical advice. Ingestion: Rinse mouth. Do not induce vomiting. Call a POISON CENTER or doctor if you feel unwell.
Disposal	Chemical waste through a licensed contractor; do not pour down the drain.
Transport	Not regulated as a dangerous good (DOT / IATA / IMDG).

Download the SDS (PDF) Read the full safety data sheet All safety data sheets

For laboratory research use only. Not for human or veterinary use.

3 reviews for cagrilintide 2.5mg + semaglutide 2.5mg

Buford Lassiter

Rated 5 out of 5

October 8, 2026

great

thanks

Helpful? 0 0

Ramona Estevez

Rated 5 out of 5

July 31, 2026

My obesity research finally has a reliable source

I've been running weight management research for about 3 years now, and the last 18 months have been all about the GLP-1 and amylin combination - it's...More
I've been running weight management research for about 3 years now, and the last 18 months have been all about the GLP-1 and amylin combination - it's the most interesting thing to happen in this space in decades. The problem has always been sourcing. Semaglutide is everywhere since it got famous, but cagrilintide is genuinely hard to find, and finding both pre-combined in a single vial at consistent ratios was basically impossible until I found PrymaLab. My first order arrived in 3 days. The padded mailer had the vial wrapped snugly, the seal was intact, and the label clearly listed both compounds with the lot number printed right on it. The solution reconstituted completely clear - no cloudiness, no particles. I've placed six orders since and every one has been identical. My previous vendors made me feel like I was gambling every time I hit checkout. These folks make me feel like a customer. For research that depends on consistent inputs, that's everything. Five stars.

Helpful? 0 0

Curtis Vance

Rated 5 out of 5

July 28, 2026

The combo nobody else carries

I've been following the dual agonist research for a while now and the frustrating thing has always been sourcing - most vendors carry semaglutide, a h...More
I've been following the dual agonist research for a while now and the frustrating thing has always been sourcing - most vendors carry semaglutide, a handful carry cagrilintide, and almost nobody offers them pre-combined in one vial. Which matters, because when you're running appetite and satiety research, compounding your own combo introduces variables you don't want. PrymaLab's pre-combined 2.5 + 2.5 vial solved that. The label lists both compounds with the amounts, the lot number is printed right on it, and the vial arrives sealed and dissolves completely clear. Shipping was 2 days. If your research involves the GLP-1 plus amylin pathway, this is the vial you've been looking for.

Helpful? 0 0

Only logged in customers who have purchased this product may leave a review.

Customer reviews

5.00

Rated 5 out of 5

Based on 3 reviews

100%

Rated 4 out of 5

Rated 3 out of 5

Rated 2 out of 5

Rated 1 out of 5

Buford Lassiter

October 8, 2026

great

thanks

Helpful? 0 0

Ramona Estevez

July 31, 2026

My obesity research finally has a reliable source

I've been running weight management research for about 3 years now, and the last 18 months have been all about the GLP-1 and amylin combination - it's...More

I've been running weight management research for about 3 years now, and the last 18 months have been all about the GLP-1 and amylin combination - it's the most interesting thing to happen in this space in decades. The problem has always been sourcing. Semaglutide is everywhere since it got famous, but cagrilintide is genuinely hard to find, and finding both pre-combined in a single vial at consistent ratios was basically impossible until I found PrymaLab. My first order arrived in 3 days. The padded mailer had the vial wrapped snugly, the seal was intact, and the label clearly listed both compounds with the lot number printed right on it. The solution reconstituted completely clear - no cloudiness, no particles. I've placed six orders since and every one has been identical. My previous vendors made me feel like I was gambling every time I hit checkout. These folks make me feel like a customer. For research that depends on consistent inputs, that's everything. Five stars.

Curtis Vance

July 28, 2026

The combo nobody else carries

I've been following the dual agonist research for a while now and the frustrating thing has always been sourcing - most vendors carry semaglutide, a h...More

I've been following the dual agonist research for a while now and the frustrating thing has always been sourcing - most vendors carry semaglutide, a handful carry cagrilintide, and almost nobody offers them pre-combined in one vial. Which matters, because when you're running appetite and satiety research, compounding your own combo introduces variables you don't want. PrymaLab's pre-combined 2.5 + 2.5 vial solved that. The label lists both compounds with the amounts, the lot number is printed right on it, and the vial arrives sealed and dissolves completely clear. Shipping was 2 days. If your research involves the GLP-1 plus amylin pathway, this is the vial you've been looking for.

cagrilintide 2.5mg + semaglutide 2.5mg

Description