Description
PrymaLab · Research use only
Preloaded Autoinjector | IGF-DES | 3ml Pen | 1mg/ml
Des(1-3)IGF-1 in bacteriostatic water at 1 mg/mL, 3 mg in a preloaded 3 mL pen
IGF-1 DES, or des(1-3)IGF-1, is human insulin-like growth factor 1 with its first three residues removed, a 67-residue protein held together by three disulfides. This listing is a preloaded autoinjector pen containing 3 mg of it in 3 mL of bacteriostatic water. Studies of the truncated protein have dealt with its potency in cultured muscle cells, its weak binding to IGF-binding proteins and its fate in rat plasma.
Specifications
| Property | Value |
|---|---|
| Compound | IGF-1 DES(1-3) Des(1-3)-IGF-1; recombinant human IGF-1 lacking the N-terminal Gly-Pro-Glu |
| CAS number | 112603-35-7 |
| Molecular formula | C 319 H 501 N 91 O 96 S 7 (reduced-chain calculation) |
| Theoretical mass | 7371.5 Da (reduced-chain calculation; 7365.4 Da with the three disulfides formed) |
| Sequence / structure | H-TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA-OH (67 residues; three intrachain disulfides; free N- and C-termini) |
| Contents | IGF-1 DES(1-3): 3 mg per 3 mL pen (0.1% w/v) |
| Form | Sterile aqueous solution in bacteriostatic water (0.9% benzyl alcohol), supplied in a 3 mL glass cartridge inside a preloaded autoinjector pen fitted with a needle |
| Storage, sealed | Store at 2–8 °C in the original carton, protected from light |
| Safety data sheet | PL-SDS-085 |
What is in the pen
The 3 mL cartridge holds sterile solution with IGF-1 DES at 0.1% w/v: 1 mg/mL and 3 mg per pen, or roughly 0.14 mM at the folded mass of 7365.4 Da. It is dissolved in bacteriostatic water preserved with 0.9% benzyl alcohol. On the safety data sheet the protein is not classified, while benzyl alcohol carries warnings for harm if swallowed or inhaled, eye irritation and skin sensitisation. Store the pen refrigerated at 2 to 8 °C in its carton and away from light, keep it capped once started, and do not let it freeze; a frozen, discoloured or cloudy solution should be discarded. The IGF-DES 2 mg vial supplies the same protein freeze-dried, and peptide pen vs vial sets out the general differences.
What the research covers
The truncated form was first isolated from bovine colostrum, where it occurred alongside IGF-1 and IGF-2 and differed from IGF-1 only by lacking the N-terminal Gly-Pro-Glu1. In cultured L6 myoblasts, destripeptide IGF-1 stimulated protein synthesis at roughly seven-fold the potency of IGF-1, whether purified or chemically synthesised, but competed no better for IGF-1 binding to the cells2.
The explanation lies with the IGF-binding proteins. Ballard and colleagues found that in rat plasma the labelled truncated protein barely associated with binding proteins, stayed mostly free in the circulation and was cleared far faster than IGF-I or IGF-II, with a larger volume of distribution3. More of the radioactivity reached the adrenals, brain, skin and gut with des(1-3)IGF-I than with the other two peptides3.
These are rat and cell culture findings, and none of them tested the protein after storage in bacteriostatic water or compared the solution with freeze-dried material. The IGF-1 LR3 guide covers the wider IGF-1 analogue literature, including how DES and LR3 differ.
How each lot is tested
Every lot is tested in PrymaLab’s own laboratory in Ashland, Kentucky before release: RP-HPLC for purity, LC-MS for identity, Karl Fischer titration for water, LAL for endotoxin and USP <71> for sterility. Published certificates are listed on the results page and can be checked by number and key on the verify page. The certificate covers the peptide lot used to fill the pen, not the finished solution. These are in-house results from PrymaLab Analytical, not an independent test, and the lab is not accredited to ISO 17025. The third-party testing guarantee on this page still applies: if any independent laboratory finds the wrong compound, or less than the stated purity or amount, the order is refunded and the cost of the test is reimbursed.
Frequently asked questions
How does the pen compare with the 2 mg vial?
The vial supplies 2 mg of dry protein that stays at −20 °C until a laboratory dissolves it. The pen arrives as a solution, 3 mg in 3 mL at 1 mg/mL, and is kept refrigerated. Both contain the same 67-residue des(1-3)IGF-1.
Is IGF-1 DES the same as IGF-1 LR3?
No. DES removes the first three residues of IGF-1, while LR3 adds a 13-residue extension and changes residue 3. They have different sequences and masses and are sold as separate products.
What does the certificate cover?
The certificate belongs to the protein lot that filled the pen and reports its purity, LC-MS identity, water, endotoxin and sterility. It does not test the solution in the finished cartridge, which is why the storage conditions on the safety data sheet matter.
Can the pen be used in people or animals?
No. The IGF-1 DES pen is a laboratory research product with no approval for human or veterinary use. It must not be given to people or animals.
References
- Francis GL, Upton FM, Ballard FJ, et al. Insulin-like growth factors 1 and 2 in bovine colostrum. Sequences and biological activities compared with those of a potent truncated form. Biochem J. 1988;251(1):95-103. DOI · PubMed
- Ballard FJ, Francis GL, Ross M, et al. Natural and synthetic forms of insulin-like growth factor-1 (IGF-1) and the potent derivative, destripeptide IGF-1: biological activities and receptor binding. Biochem Biophys Res Commun. 1987;149(2):398-404. DOI · PubMed
- Ballard FJ, Knowles SE, Walton PE, et al. Plasma clearance and tissue distribution of labelled insulin-like growth factor-I (IGF-I), IGF-II and des(1-3)IGF-I in rats. J Endocrinol. 1991;128(2):197-204. DOI · PubMed
Research use only
For laboratory research use only. This product is not a drug, food, cosmetic or dietary supplement, is not approved by the FDA or any comparable authority for human or veterinary use, and must not be given to people or animals. It is sold to qualified researchers and institutions, and the buyer is responsible for lawful handling and disposal.
Other formats of IGF-DES
IGF-DES is also stocked as IGF-1 DES Nasal Spray, IGF-1 LR3 Nasal Spray, IGF1 LR3 1MG and IGF1 LR3 1mg/ml preloaded 3ml pen. Each listing states its own quantity and concentration, and the pen and vial comparison explains what changes between formats.
7 reviews for Preloaded Autoinjector | IGF-DES | 3ml Pen | 1mg/ml