PrymaLab AnalyticalCertificate of Analysis · Lot release · tested in-housePrymaLab Analytical · Attn: Sample intake · 3705 Music Branch Rd · Ashland, KY 41102 · United States
Certificate number
PL-26-00385
Key
RCLKFCBL
Verify at prymalab.net/testing/verify/
Teriparatide 10 mg Lot PL-2610-272 · analysed October 9, 2026 · issued October 26, 2026
Purity · RP-HPLC99.49%Specification ≥ 99.0% • main peak at 11.57 min
Identity · Observed Mass4,117.77 DaTheoretical 4,117.80 Da • −0.03 Da (7 ppm)
ConclusionPASSMeets every specification for the tests performed
The certificate
Summary
| Compound | Teriparatide |
|---|---|
| CAS number | 52232-67-4 |
| Theoretical mass | 4,117.80 Da |
| Sequence / structure | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Storage | — |
| Label claim | 10 mg per vial |
| Lot number | PL-2610-272 |
| Certificate number | PL-26-00385 |
| Date of analysis | 2026-10-09 (retest 2028-10-08) |
| Purity (RP-HPLC) | 99.49% |
| Identity (LC-MS) | 4,117.77 Da |
| Water content (KF) | 1.39% |
| Endotoxin (LAL) | 0.151 EU/mg |
| Sterility | No growth |
| Conclusion | PASS |
| Tested by | PrymaLab Analytical (PrymaLab's own laboratory, Ashland, KY). In-house result, not an independent third-party test. |
Third-party testing guarantee. Have this product tested by any independent laboratory. If the result does not come back as the compound named on the label, at the purity and amount stated, we refund your order in full and reimburse the cost of the test. Email the lab report and your order number to michael@prymalab.net.
View the product Download the PDF Print-ready certificate Verify another certificate All PrymaLab lot certificates
