PrymaLab AnalyticalCertificate of Analysis · Lot release · tested in-housePrymaLab Analytical · Attn: Sample intake · 3705 Music Branch Rd · Ashland, KY 41102 · United States
Certificate number
PL-26-00269
Key
SQGKUBXY
Verify at prymalab.net/testing/verify/
PNC-27 10 mg Lot PL-2610-155 · analysed October 7, 2026 · issued October 21, 2026
Purity · RP-HPLC99.50%Specification ≥ 99.0% • main peak at 16.51 min
Identity · Observed Mass4,031.60 DaTheoretical 4,031.70 Da • −0.10 Da (25 ppm)
ConclusionPASSMeets every specification for the tests performed
The certificate
Summary
| Compound | PNC-27 p53(12–26) fused to a membrane-residency peptide |
|---|---|
| CAS number | 1159861-00-3 |
| Molecular formula | C188H293N53O44S |
| Theoretical mass | 4,031.70 Da |
| Sequence / structure | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
| Storage | −20 °C, desiccated, dark |
| Label claim | 10 mg per vial |
| Lot number | PL-2610-155 |
| Certificate number | PL-26-00269 |
| Date of analysis | 2026-10-07 (retest 2028-10-06) |
| Purity (RP-HPLC) | 99.50% |
| Identity (LC-MS) | 4,031.60 Da |
| Water content (KF) | 3.15% |
| Endotoxin (LAL) | 0.022 EU/mg |
| Sterility | No growth |
| Conclusion | PASS |
| Tested by | PrymaLab Analytical (PrymaLab's own laboratory, Ashland, KY). In-house result, not an independent third-party test. |
Third-party testing guarantee. Have this product tested by any independent laboratory. If the result does not come back as the compound named on the label, at the purity and amount stated, we refund your order in full and reimburse the cost of the test. Email the lab report and your order number to michael@prymalab.net.
View the product Download the PDF Print-ready certificate Verify another certificate All PrymaLab lot certificates
